PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g00480.1
Common NameLR48_Vigan02g251700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family B3
Protein Properties Length: 291aa    MW: 33439.6 Da    PI: 9.551
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g00480.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B339.59.8e-1312861797
                    E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3 17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                     +p kf+++hg+    +  ++l+ +++++W v+   ++  g+++l kGWkeFv+   L  g fv+Fk++g+s+    v+++
  Vang06g00480.1 12 KVPSKFTRKHGSF--LPNPVSLRPPDSKEWVVYW--TQENGEVWLDKGWKEFVENYSLSYGYFVMFKFKGTSQI--DVTIL 86
                    58********766..4556***************..999999*************************9987655..66665 PP

2B335.81.4e-112262783387
                     -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
              B3  33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                     +k+++  + ++r+W vkli ++ +   v+++GW++F+k+ +L++ D+++F+l++ 
  Vang06g00480.1 226 QKDVM-LQMENREWWVKLICCREKYD-VFSSGWSKFAKESNLEVDDVCIFELIDP 278
                     23444.44477*******88777766.7999********************9874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.478189IPR003340B3 DNA binding domain
SMARTSM010191.0E-7189IPR003340B3 DNA binding domain
SuperFamilySSF1019367.46E-17989IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.0E-181189IPR015300DNA-binding pseudobarrel domain
PfamPF023621.2E-91280IPR003340B3 DNA binding domain
CDDcd100173.96E-111387No hitNo description
SMARTSM010190.0019167289IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.0E-12193288IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-12193287IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.32199290IPR003340B3 DNA binding domain
CDDcd100171.54E-7213289No hitNo description
PfamPF023624.2E-9225279IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
LFRILMLGSL QKVPSKFTRK HGSFLPNPVS LRPPDSKEWV VYWTQENGEV WLDKGWKEFV  60
ENYSLSYGYF VMFKFKGTSQ IDVTILDPSA VELDYFSSGK ESVNTMNVTQ MEQEPRPMSS  120
MVPSQPCGKT QNVERDANVQ QQVYADKGGP SHQGTNVQKI IKQQPNWVKS TLSGKCLNKP  180
RSLKAQKITK NFKSKYPYFT SLIVQAKLEE NATKHVPKFL NCMRGQKDVM LQMENREWWV  240
KLICCREKYD VFSSGWSKFA KESNLEVDDV CIFELIDPAI PMLRVHVVKS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014512001.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLA0A0L9U1020.0A0A0L9U102_PHAAN; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.15e-21B3 family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]